{ "action" : "addClassName" "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); lithstudio: [], "actions" : [ }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "QuickReply", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "kudosLinksDisabled" : "false", ] { "action" : "rerender" } logmein: [76, 79, 71, 77, 69, 73, 78], } "context" : "", }, "event" : "deleteMessage", } ] "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ ;(function($) { LITHIUM.AjaxSupport.ComponentEvents.set({ { } { "dialogContentCssClass" : "lia-panel-dialog-content", ;(function($) { } }); // We're good so far. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAnswerForm", if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "eventActions" : [ Online-Spiele sind oft eine große Her­aus­forderung. "actions" : [ "useCountToKudo" : "false", resetMenu(); "revokeMode" : "true", }, ] }); { ] }; "actions" : [ "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); var keycodes = { } ] LITHIUM.AjaxSupport.ComponentEvents.set({ count = 0; "initiatorBinding" : true, "actions" : [ ], "context" : "", if ( !watching ) { "actions" : [ "context" : "", { Meine Internetverbindung (LAN und WLAN) ist seit Dienstag 12.01.2021 in erheblichen Maßen gestört. "selector" : "#kudosButtonV2_2", "action" : "rerender" createStorage("true"); ] //$('#community-menu-toggle').removeClass('active') "message" : "2197073", } { var watching = false; "actions" : [ { È possibile dare priorità al mio computer anche solo nei momenti in cui gioco? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "context" : "", { } "event" : "removeMessageUserEmailSubscription", "event" : "ProductAnswer", var element = $(this).parent('li'); } watching = false; "disableKudosForAnonUser" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", } { $(document).ready(function(){ "event" : "markAsSpamWithoutRedirect", $('#node-menu li.active').children('ul').show(); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); if(do_scroll == "true"){ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "event" : "MessagesWidgetEditAction", Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", }, ] }); }, { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" } else { if ( count == neededkeys.length ) { }, "event" : "ProductAnswerComment", "message" : "2197073", "action" : "rerender" "action" : "rerender" ] "componentId" : "forums.widget.message-view", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65addd5a1896b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { }, "actions" : [ "actions" : [ { "context" : "", "useSimpleView" : "false", "context" : "envParam:feedbackData", { ] "forceSearchRequestParameterForBlurbBuilder" : "false", ] "action" : "rerender" "event" : "ProductMessageEdit", "disableLinks" : "false", // Set start to true only if the first key in the sequence is pressed { "context" : "", "context" : "envParam:entity", "}); }, ], "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", { // enable redirect to login page when "logmein" is typed into the void =) "actions" : [ ] "action" : "rerender" "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); }, { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "disableKudosForAnonUser" : "false", "event" : "AcceptSolutionAction", }, } return; } "disableKudosForAnonUser" : "false", { { { "action" : "rerender" "context" : "", // Oops, not the right sequence, lets restart from the top. } "event" : "deleteMessage", ] "action" : "rerender" { } ] "truncateBodyRetainsHtml" : "false", { "action" : "pulsate" { "initiatorBinding" : true, "action" : "rerender" } "event" : "removeMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", ] "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2194592,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:selectedMessage", "actions" : [ { ] var clickedDomElement = $(this); } \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; }, "context" : "envParam:quiltName", "accessibility" : false, ] "action" : "pulsate" "action" : "rerender" "action" : "rerender" "context" : "envParam:entity", "useTruncatedSubject" : "true", Follow these instructions to connect your Vodafone Station in just a few easy steps. "initiatorDataMatcher" : "data-lia-kudos-id" }); }, var position_x = msg.offset(); { { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234347}); "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] ] })(LITHIUM.jQuery); "linkDisabled" : "false" "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234347}); { } }, "action" : "rerender" "context" : "", }, ] // --> ] }(LITHIUM.jQuery)); "eventActions" : [ LITHIUM.Dialog({ LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } "disableKudosForAnonUser" : "false", { "actions" : [ "context" : "", "event" : "addThreadUserEmailSubscription", { $(this).next().toggle(); "action" : "rerender" ;(function($) { "event" : "ProductAnswer", return; "revokeMode" : "true", "useSubjectIcons" : "true", }, "truncateBody" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '6lxfR_uH2-wqO7Mk4qAGdSvJmKAEtPEgHQ3s_s8zX8M. } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2193907}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2194560}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2194592}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2197073}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2494410}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543691}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543652}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543574}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543553}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543537}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543527}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543517}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543439}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543417}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543397}}]); { ] "context" : "envParam:quiltName,product,contextId,contextUrl", }, "actions" : [ { $(this).toggleClass("view-btn-open view-btn-close"); "action" : "rerender" "actions" : [ "event" : "removeThreadUserEmailSubscription", watching = false; ', 'ajax'); "action" : "rerender" "actions" : [ { "event" : "MessagesWidgetEditCommentForm", function createStorage(option){ "actions" : [ } This product hasn't been reviewed yet. ] return; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, // Oops. "action" : "rerender" // --> { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; watching = true; "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetCommentForm", ] ], "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2194592,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ], }, } } Your report was successfully submitted. "action" : "pulsate" { }, "event" : "unapproveMessage", })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ev4kanirJLV2vgMFGCvmajjs0GvIVGY4Odsr0kL7T1k. }, "context" : "", "event" : "ProductAnswerComment", "action" : "rerender" LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_65addd5a1896b","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "eventActions" : [ } "event" : "unapproveMessage", }, So, I have follwed your guidance and have put the orbi in AP mode. "action" : "rerender" "kudosLinksDisabled" : "false", } { "actions" : [ { }, "context" : "", var notifCount = 0; { var key = e.keyCode; else { "event" : "deleteMessage", } ] Thanks very much for your response. "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { { "event" : "MessagesWidgetEditAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "actions" : [ ] "useSubjectIcons" : "true", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "disableKudosForAnonUser" : "false", "context" : "", "actions" : [ Bist du sicher, dass du fortfahren möchtest? // --> } "selector" : "#messageview_1", "disableLabelLinks" : "false", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useTruncatedSubject" : "true", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "disableLabelLinks" : "false", } "event" : "deleteMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // We're good so far. "actions" : [ "context" : "", ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cSLy-o1S8AQTDeeZQBVHvWLwsspRaStlZfQpEtaC-08.