} }, "action" : "rerender" { "action" : "rerender" "displayStyle" : "horizontal", "event" : "MessagesWidgetMessageEdit", { "defaultAriaLabel" : "", "actions" : [ "action" : "rerender" "action" : "rerender" $(document).ready(function(){ "actions" : [ "disableLinks" : "false", } }); { { "selector" : "#messageview_8", { "event" : "MessagesWidgetEditCommentForm", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, }, "event" : "AcceptSolutionAction", ] { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); ] "event" : "editProductMessage", "actions" : [ "actions" : [ "componentId" : "kudos.widget.button", "actions" : [ { { "parameters" : { } { }, "actions" : [ "context" : "", } }, "event" : "AcceptSolutionAction", "action" : "rerender" ] } "actions" : [ "action" : "rerender" "actions" : [ { { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:feedbackData", "parameters" : { { "context" : "", ] "disableLinks" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "parameters" : { "eventActions" : [ "actions" : [ "context" : "", { { "actions" : [ "event" : "MessagesWidgetEditCommentForm", "context" : "lia-deleted-state", } "showCountOnly" : "false", "kudosable" : "true", "displaySubject" : "true", "action" : "rerender" "event" : "ProductMessageEdit", "event" : "ProductAnswer", } "action" : "rerender" "entity" : "2066635", "event" : "MessagesWidgetEditAnswerForm", } "context" : "", "useSimpleView" : "false", } else { "actions" : [ { "selector" : "#kudosButtonV2_5", { { We work side by side with you to connect people, places & things. "actions" : [ ] ] ] }, { "action" : "rerender" "actions" : [ ] "useSimpleView" : "false", { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066914 .lia-rating-control-passive', '#form_6'); // We're good so far. "selector" : "#kudosButtonV2_0", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066635 .lia-rating-control-passive', '#form_5'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2067099 .lia-rating-control-passive', '#form_7'); { "actions" : [ { "context" : "", } "actions" : [ ] "action" : "rerender" "event" : "editProductMessage", "entity" : "2067099", "actions" : [ { { } ] } ] ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ], }, "actions" : [ "displaySubject" : "true", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2065970,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] } "actions" : [ }, { Search Search Vodafone for Business. "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "disableLabelLinks" : "false", } })(LITHIUM.jQuery); } { } { { { "event" : "deleteMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "selector" : "#kudosButtonV2_8", }, "event" : "ProductAnswerComment", { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "event" : "RevokeSolutionAction", "event" : "addThreadUserEmailSubscription", } }, ] } ], } else { "useSimpleView" : "false", "event" : "AcceptSolutionAction", "action" : "rerender" }, ] { "event" : "unapproveMessage", count++; "context" : "envParam:feedbackData", ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } } } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" }, "action" : "pulsate" "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2065620,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "pulsate" ] "action" : "rerender" { "actions" : [ "actions" : [ { ] } "actions" : [ } { }, "context" : "", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'psdZynxitTPHETJ-0wVFmQ7s1cc4wrkD6F33C-g2QXI. } ] "context" : "envParam:quiltName,product,contextId,contextUrl", }, "disableKudosForAnonUser" : "false", } ], { { }, "actions" : [ ] "action" : "pulsate" } } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // We made it! "actions" : [ "event" : "ProductAnswerComment", The Future is Exciting, Ready? var keycodes = { "event" : "kudoEntity", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", ] "action" : "rerender" "disableLinks" : "false", { { "action" : "rerender" }, }, "event" : "MessagesWidgetEditCommentForm", if ( watching ) { ] { "accessibility" : false, "event" : "addThreadUserEmailSubscription", "action" : "rerender" } { }, ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "disableKudosForAnonUser" : "false", }, "event" : "ProductAnswer", }, { }, } { } var watching = false; "parameters" : { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", } "context" : "envParam:quiltName,expandedQuiltName", { }); "context" : "", } "disallowZeroCount" : "false", "actions" : [ }, "event" : "ProductAnswer", "disableLabelLinks" : "false", { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "action" : "rerender" }, } "event" : "unapproveMessage", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, { "action" : "pulsate" }, "actions" : [ "event" : "ProductMessageEdit", } { "actions" : [ ], { } "action" : "pulsate" "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { { "actions" : [ "actions" : [ "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName", "context" : "lia-deleted-state", Bist du sicher, dass du fortfahren möchtest? { ] "useTruncatedSubject" : "true", } } "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); ] } } "useSubjectIcons" : "true", })(LITHIUM.jQuery); }, }, }, ] "triggerEvent" : "click", ] "event" : "kudoEntity", "actions" : [ "eventActions" : [ "selector" : "#kudosButtonV2_0", count = 0; ] { LITHIUM.Dialog.options['605377554'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "initiatorDataMatcher" : "data-lia-kudos-id" })(LITHIUM.jQuery); { "actions" : [ { "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? // If watching, pay attention to key presses, looking for right sequence. "truncateBodyRetainsHtml" : "false", }, "disableLinks" : "false", ] } "action" : "pulsate" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "event" : "MessagesWidgetEditAction", "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" }, "context" : "envParam:quiltName", } "action" : "rerender" "event" : "addThreadUserEmailSubscription", "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" { "actions" : [ "context" : "envParam:selectedMessage", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ ] .attr('aria-expanded','true'); ] "revokeMode" : "true", { "action" : "rerender" element.siblings('li').children('ul').slideUp(); }, }, $(document).keydown(function(e) { "action" : "rerender" "truncateBodyRetainsHtml" : "false", { "forceSearchRequestParameterForBlurbBuilder" : "false", } { "event" : "MessagesWidgetEditAction", "action" : "rerender" }, { { { { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] { "initiatorDataMatcher" : "data-lia-kudos-id" ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "ProductMessageEdit", } "action" : "rerender" return; LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] }, "actions" : [ "event" : "ProductAnswerComment", ctaHTML += 'Stell Deine Frage'; }, "event" : "removeMessageUserEmailSubscription", "kudosLinksDisabled" : "false", { "context" : "", "actions" : [ LITHIUM.Dialog.options['-1174512196'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "context" : "envParam:selectedMessage", "displayStyle" : "horizontal", "action" : "rerender" "context" : "", { "useSubjectIcons" : "true", ], { { ] }; "actions" : [ { // Oops. "context" : "", "event" : "ProductAnswerComment", } "context" : "envParam:quiltName", var count = 0; "actions" : [ "actions" : [ Bist du sicher, dass du fortfahren möchtest? "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "event" : "QuickReply", }, "useSubjectIcons" : "true", ], "displayStyle" : "horizontal", { "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); }, "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "QuickReply", { // Oops, not the right sequence, lets restart from the top. "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "event" : "unapproveMessage", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "componentId" : "kudos.widget.button", "truncateBody" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { "event" : "MessagesWidgetEditCommentForm", { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "disallowZeroCount" : "false", ] { }, "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ', 'ajax'); ] ] ] '; { "event" : "editProductMessage", ] "context" : "", { } "context" : "lia-deleted-state", ] { "context" : "envParam:entity", }, "context" : "envParam:quiltName,product,contextId,contextUrl", }, "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Mobile Connectivity solutions for multinational organisations. "actions" : [ Intern lautet die Anweisung meiner Kenntnis nach zu Dual Stack "Nicht buchen". LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); ], "actions" : [ } }; "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1926,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1kEBBwBxcnABRMXAURWgFZV0FcAlMIFHsMFlIWW1ZAHzFgOhZ2FwNbSWZHVVEOaklNVk8Sa0sHAwIHUwZTGx5ABEUFWFZ9VkcMVwsGVFsDXAILBgpWGkRSUTcRUhZ8VxYISAdKG1kBMlYDUH1VXwAUXBt0DRBCCWFcRFsGZgdeV0BOFQ9WfltQDFoDGwhABFYIRlYWHkddBXtdFkANRlNSWEEAFEobWQE2T0YPEVFWVlNXXAQBTwcFDVcZBlUDBxQLUVVTSVYAAwcBBwQJCgQBUUYZEV9RK1kCXHsGQA1GZkdbQBBYAUpfBw5TEVtUUVwsWBJcQAwHQzBjZ1FeAFAJVxBOQFwHZ1ZHRjMEN0xXEBsVXhdgcX4gdTIZWwZCcTZ6fhRfAEUVWFUHERczfXZmd0VCCUlbAUxeAAgMFH4sey9tEl1AShk="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ }, "buttonDialogCloseAlt" : "Schließen", { "actions" : [ { { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "disableLinks" : "false", $(document).ready(function(){ "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" { } }, ] "useCountToKudo" : "false", ] "action" : "rerender" "context" : "lia-deleted-state", } "action" : "rerender" ] "event" : "addThreadUserEmailSubscription", } } "actions" : [ ] }, "actions" : [ { }, ] "action" : "rerender" } "context" : "", "eventActions" : [ { "event" : "MessagesWidgetEditAnswerForm", { "messageViewOptions" : "1111110111111111111110111110100101001101" }, "actions" : [ "actions" : [ "action" : "rerender" "action" : "rerender" { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); { "defaultAriaLabel" : "", "initiatorBinding" : true, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}});